Proteintech, 24861-1-AP, ZNF195 Polyclonal antibody

Size: 20ul / 150ul The ZNF195 (24861-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF195 in WB, ELISA applications with reactivity to human, mouse samples 24861-1-AP targets ZNF195 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: fetal human brain tissue, human heart tissue, mouse skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21735 Product name: Recombinant human ZNF195 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 69-174 aa of BC121029 Sequence: EAADGHPEMGFHHATQACLELLGSSDLPASASQSAGITGVNHRAQPGLNVSVDKFTAMSSHFTQDLLPEQGIQDAFPKRILRGYGNCGLDNLYLRKDWESLDECKL Predict reactive species Full Name: zinc finger protein 195 Calculated Molecular Weight: 629 aa, 72 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC121029 Gene Symbol: ZNF195 Gene ID (NCBI): 7748 RRID: AB_2879760 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14628 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.