Iright
BRAND / VENDOR: Proteintech

Proteintech, 24864-1-AP, FUBP1 Polyclonal antibody

CATALOG NUMBER: 24864-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FUBP1 (24864-1-AP) by Proteintech is a Polyclonal antibody targeting FUBP1 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 24864-1-AP targets FUBP1 in WB, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells, Jurkat cells, K-562 cells, mouse brain tissue Positive IP detected in: SH-SY5Y cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FUBP1 also termed as FBP and FUSE-binding protein 1 is 644 amino-acid protein, which localizes in the nucleus. FUBP1 binds to a single-stranded far-upstream element (FUSE) upstream of the MYC promoter and regulates the MYC expression, indicating that FBP1 functions as a growth-dependent regulator of c-Myc expression. FUBP1 binds to FUSE, and PUF60, and forms a stable tripartite complex, which represses activated but not basal c-myc transcription after transcription initiation by delaying promoter escape. FUBP1 may be acting both as activator and repressor of transcription. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13149 Product name: Recombinant human FUBP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 303-653 aa of BC017247 Sequence: DAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGNPGGPGPGGRGRGRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTPMGPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAYYAHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPTGAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQCRFDPASIELAL Predict reactive species Full Name: far upstream element (FUSE) binding protein 1 Calculated Molecular Weight: 653 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC017247 Gene Symbol: FUBP1 Gene ID (NCBI): 8880 RRID: AB_2879762 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96AE4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924