Product Description
Size: 20ul / 150ul
The ZNF320 (24882-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF320 in WB, ELISA applications with reactivity to human, rat samples
24882-1-AP targets ZNF320 in WB, ELISA applications and shows reactivity with human, rat samples.
Tested Applications
Positive WB detected in: HEK-293 cells, L02 cells
Recommended dilution
Western Blot (WB): WB : 1:200-1:1000
Specification
Tested Reactivity: human, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag21688 Product name: Recombinant human ZNF320 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 190-238 aa of BC131555 Sequence: KCKVCDKAFKHDSHLAKHTRIHRGDKHYTCNECGKVFDQKATLACHHRS Predict reactive species
Full Name: zinc finger protein 320
Calculated Molecular Weight: 509 aa, 59 kDa
Observed Molecular Weight: 40-45 kDa
GenBank Accession Number: BC131555
Gene Symbol: ZNF320
Gene ID (NCBI): 162967
RRID: AB_2879777
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: A2RRD8
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924