Proteintech, 24903-1-AP, SOX17 Polyclonal antibody

Size: 20ul / 150ul The SOX17 (24903-1-AP) by Proteintech is a Polyclonal antibody targeting SOX17 in WB, ELISA applications with reactivity to human, mouse, rat samples 24903-1-AP targets SOX17 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C6 cells, PC-3 cells, mouse embryo Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Transcription factor SOX 17 (SOX17) also named as SRY box 17 is a 414 amino acid protein, which contains one Sox C-terminal domain and one HMG box DNA-binding domain. SOX17 as a transcription regulator binds target promoter DNA and bend the DNA via WNT3A. SOX17 is a marker of endodermal cells and a transcriptional regulator containing a DNA binding domain called the HMG box. In mouse embryos, SOX17 plays critical roles in the growth and differentiation of definitive endodermal cells (PMID: 11973269), the remodeling of endothelial cells (PMID: 16895970), hindgut endoderm expansion with localization of primordial germ cells (PMID: 19371732), and gallbladder/bile duct formation (PMID: 19913509). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19157 Product name: Recombinant human SOX17 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-66 aa of BC111365 Sequence: MSSPDAGYASDDQSQTQSALPAVMAGLGPCPWAESLSPIGDMKVKGEAPANSGAPAGAAGRAKGES Predict reactive species Full Name: SRY (sex determining region Y)-box 17 Calculated Molecular Weight: 414 aa, 44 kDa Observed Molecular Weight: 44 kDa GenBank Accession Number: BC111365 Gene Symbol: SOX17 Gene ID (NCBI): 64321 RRID: AB_2879789 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H6I2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.