Iright
BRAND / VENDOR: Proteintech

Proteintech, 24914-1-AP, INTU Polyclonal antibody

CATALOG NUMBER: 24914-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The INTU (24914-1-AP) by Proteintech is a Polyclonal antibody targeting INTU in WB, IHC, ELISA applications with reactivity to human, mouse samples 24914-1-AP targets INTU in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse liver tissue, mouse heart tissue, mouse skeletal muscle tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information INTU also named as KIAA1284, PDZD6, and PDZK6 is a 942 amino-acid protein, which belongs to the inturned family. INTU contains a PDZ domain and localizes in cytoplasm. Intu, a tissue-specific PCP effector gene, play a role in the context of skin and hair follicle development. Intu is expressed in both epidermal and dermal cells of the skin. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19313 Product name: Recombinant human INTU protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-354 aa of BC130611 Sequence: MASVASCDSRPSSDELPGDPSSQEEDEDYDFEDRVSDSGSYSSASSDYDDLEPEWLDSVQKNGELFYLELSEDEEESLLPETPTVNHVRFSENEIIIEDDYKERKKYEPKLKQFTKILRRKRLLPKRCNKKNSNDNGPVSILKHQSNQKTGVIVQQRYKDVNVYVNPKKLTVIKAKEQLKLLEVLVGIIHQTKWSWRRTGKQGDGERLVVHGLLPGGSAMKSGQVLIGDVLVAVNDVDVTTENIERVLSCIPGPMQVKLTFENAYDVKRETSHPRQKKTQSNTSDLVKLLWGEEVEGIQQSGLNTPHIIMYLTLQLDSETSKEEQEILYHYPMSEASQKLKSVRGIFLTLCDML Predict reactive species Full Name: inturned planar cell polarity effector homolog (Drosophila) Calculated Molecular Weight: 942 aa, 106 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC130611 Gene Symbol: INTU Gene ID (NCBI): 27152 RRID: AB_2879794 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULD6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924