Iright
BRAND / VENDOR: Proteintech

Proteintech, 24919-1-AP, FAM82B Polyclonal antibody

CATALOG NUMBER: 24919-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM82B (24919-1-AP) by Proteintech is a Polyclonal antibody targeting FAM82B in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 24919-1-AP targets FAM82B in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, rat heart tissue Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information FAM82B, also known as RMDN1 or CGI90, belongs to the FAM82/RMD family. FAM82B is a microtubule-associated protein with potential roles in regulating microtubule dynamics and other cellular functions. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20679 Product name: Recombinant human FAM82B protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-314 aa of BC009671 Sequence: MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGTFKRGLLLSALSYLGFETYQVISQAAVVHATAKVEEILEQADYLYESGETEKLYQLLTQYKESEDAELLWRLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHLMGIWCYTFAEMPWYQRRIAKMLFATPPSSTYEKALGYFHRAEQVDPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPAHTEEDKQIQTEAAQLLTSFSEKN Predict reactive species Full Name: family with sequence similarity 82, member B Calculated Molecular Weight: 314 aa, 36 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC009671 Gene Symbol: FAM82B Gene ID (NCBI): 51115 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96DB5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924