Proteintech, 24930-1-AP, C2orf47 Polyclonal antibody

Size: 20ul / 150ul The C2orf47 (24930-1-AP) by Proteintech is a Polyclonal antibody targeting C2orf47 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24930-1-AP targets C2orf47 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, HeLa cells, PC-3 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information C2orf47, also named matrix AAA peptidase interacting protein 1 (MAIP1), is a 291 amino-acid protein that localizes in the Mitochondrion. C2orf47 is involved in protecting EMRE, a component of the single calcium complex (MCU), from proteolysis by assisting membrane insertion. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21518 Product name: Recombinant human C2orf47 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-291 aa of BC017959 Sequence: MALAARLLPQFLHSRSLPCGAVRLRTPAVAEVRLPSATLCYFCRCRLGLGAALFPRSARALAASALPAQGSRWPVLSSPGLPAAFASFPACPQRSYSTEEKPQQHQKTKMIVLGFSNPINWVRTRIKAFLIWAYFDKEFSITEFSEGAKQAFAHVSKLLSQCKFDLLEELVAKEVLHALKEKVTSLPDNHKNALAANIDEIVFTSTGDISIYYDEKGRKFVNILMCFWYLTSANIPSETLRGASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE Predict reactive species Full Name: chromosome 2 open reading frame 47 Calculated Molecular Weight: 291 aa, 33 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC017959 Gene Symbol: C2orf47 Gene ID (NCBI): 79568 RRID: AB_2879804 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWC4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.