Iright
BRAND / VENDOR: Proteintech

Proteintech, 24946-1-AP, PRPF38A Polyclonal antibody

CATALOG NUMBER: 24946-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PRPF38A (24946-1-AP) by Proteintech is a Polyclonal antibody targeting PRPF38A in WB, IF/ICC, ELISA applications with reactivity to human samples 24946-1-AP targets PRPF38A in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: K-562 cells, HepG2 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information PRPF38A was identified as an essential splicing factor in yeast and was found to be important for the progression of the splicing process to the first splicing step in this organism. PRPF38A is one of nine splicing factors that are specifically incorporated during the formation of the pre-catalytic spliceosomal B complex (B-specific proteins) and that are released again during spliceosome activation3 (PMID: 35869234). PRPF38A knockdown led to widespread intronic retention and altered splicing of transcripts of genes implicated in protein metabolism, mitosis, proteasome function and apoptosis (PMID: 28878028). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag20980 Product name: Recombinant human PRPF38A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 188-312 aa of BC000777 Sequence: MDDVESSEEEEEEDEKLERVPSPDHRRRSYRDLDKPRRSPTLRYRRSRSRSPRRRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSKSPGHHRSHRHRSHSKSPERSKKSHKKSRRGNE Predict reactive species Full Name: PRP38 pre-mRNA processing factor 38 (yeast) domain containing A Calculated Molecular Weight: 312 aa, 37 kDa Observed Molecular Weight: 37-40 kDa GenBank Accession Number: BC000777 Gene Symbol: PRPF38A Gene ID (NCBI): 84950 RRID: AB_2879814 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NAV1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924