Proteintech, 24949-1-AP, HIC1 Polyclonal antibody

Size: 20ul / 150ul The HIC1 (24949-1-AP) by Proteintech is a Polyclonal antibody targeting HIC1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 24949-1-AP targets HIC1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, NIH/3T3 cells Positive IHC detected in: rat lung tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21849 Product name: Recombinant human HIC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 89-408 aa of BC157027 Sequence: DGAEAAAAAAVAPGAEPSLGAVLAAASYLQIPDLVALCKKRLKRHGKYCHLRGGGGGGGGYAPYGRPGRGLRAATPVIQACYPSPVGPPPPPAAEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEAAPPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERGGDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYPCPHLAYG Predict reactive species Full Name: hypermethylated in cancer 1 Calculated Molecular Weight: 714 aa, 75 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC157027 Gene Symbol: HIC1 Gene ID (NCBI): 3090 RRID: AB_2879816 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14526 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.