Iright
BRAND / VENDOR: Proteintech

Proteintech, 24959-1-AP, BTNL8 Polyclonal antibody

CATALOG NUMBER: 24959-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BTNL8 (24959-1-AP) by Proteintech is a Polyclonal antibody targeting BTNL8 in WB, IHC, ELISA applications with reactivity to human samples 24959-1-AP targets BTNL8 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21203 Product name: Recombinant human BTNL8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 90-147 aa of BC119696 Sequence: CSMRHAHLSREVESRVQIGDTFFKPISWHLATKVLGILCCGLFFGIVGLKIFFSKFQW Predict reactive species Full Name: butyrophilin-like 8 Calculated Molecular Weight: 500 aa, 57 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC119696 Gene Symbol: BTNL8 Gene ID (NCBI): 79908 RRID: AB_2879822 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UX41 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924