Iright
BRAND / VENDOR: Proteintech

Proteintech, 24974-1-AP, ZNF114 Polyclonal antibody

CATALOG NUMBER: 24974-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF114 (24974-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF114 in WB, ELISA applications with reactivity to human, mouse samples 24974-1-AP targets ZNF114 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21810 Product name: Recombinant human ZNF114 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 43-253 aa of BC125069 Sequence: AFIDWATPCKTKDATPQPDILPKRTFPEANRVCLTSISSQHSTLREDWRCPKTEEPHRQGVNNVKPPAVAPEKDESPVSICEDHEMRNHSKPTCRLVPSQGDSIRQCILTRDSSIFKYNPVLNDSQKTHENNEDDGVLGWNIQWVPCGRKTELKSSTWTGSQNTVHHIRDEIDTGANRHQRNPFGKAFREDGSLRAHNTHGREKMYDFTQC Predict reactive species Full Name: zinc finger protein 114 Calculated Molecular Weight: 417 aa, 48 kDa Observed Molecular Weight: 40-50 kDa GenBank Accession Number: BC125069 Gene Symbol: ZNF114 Gene ID (NCBI): 163071 RRID: AB_2879827 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NC26 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924