Iright
BRAND / VENDOR: Proteintech

Proteintech, 24982-1-AP, SHISA3 Polyclonal antibody

CATALOG NUMBER: 24982-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SHISA3 (24982-1-AP) by Proteintech is a Polyclonal antibody targeting SHISA3 in WB, ELISA applications with reactivity to mouse samples 24982-1-AP targets SHISA3 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SHISA3 belongs to the SHISA family and plays a role in human carcinogenesis. SHISA3 inhibits tumor initiation, invasion and metastasis by promoting the degradation of β-catenin (PMID: 31801598, PMID: 32692756). Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21751 Product name: Recombinant human SHISA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 120-238 aa of BC127690 Sequence: CCTCLRPKEPSQQPIRFSLRSYQTETLPMILTSTSPRAPSRQSSTATSSSSTGGSIRRFSFARAEPGCLVPSPPPPYTTSHSIHLAQPSGFLVSPQYFAYPLQQEPPLPGKSCPDFSSS Predict reactive species Full Name: shisa homolog 3 (Xenopus laevis) Calculated Molecular Weight: 238 aa, 26 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC127690 Gene Symbol: SHISA3 Gene ID (NCBI): 152573 RRID: AB_3669460 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A0PJX4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924