Proteintech, 24986-1-AP, AKAP4 Polyclonal antibody

Size: 20ul / 150ul The AKAP4 (24986-1-AP) by Proteintech is a Polyclonal antibody targeting AKAP4 in WB, IHC, ELISA applications with reactivity to human samples 24986-1-AP targets AKAP4 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information AKAP4, also named as A-kinase anchor protein 82 kDa, is a 854 amino acid protein, which belongs to the AKAP110 family. AKAP4 localizes to the principle piece of the sperm flagellum and is only expressed in round spermatids. AKAP4 is a major structural component of sperm fibrous sheath and plays a role in sperm motility. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21762 Product name: Recombinant human AKAP4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 565-693 aa of BC126252 Sequence: TCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQAN Predict reactive species Full Name: A kinase (PRKA) anchor protein 4 Calculated Molecular Weight: 854 aa, 94 kDa Observed Molecular Weight: 82 kDa GenBank Accession Number: BC126252 Gene Symbol: AKAP4 Gene ID (NCBI): 8852 RRID: AB_2876859 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5JQC9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.