Iright
BRAND / VENDOR: Proteintech

Proteintech, 24989-1-AP, KHDC3L Polyclonal antibody

CATALOG NUMBER: 24989-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KHDC3L (24989-1-AP) by Proteintech is a Polyclonal antibody targeting KHDC3L in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 24989-1-AP targets KHDC3L in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Positive IHC detected in: human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information KHDC3L (also known as Filia and ES cell-associated transcript1 [Ecat1]) as a key regulator in safeguarding the genomic stability of mouse early embryonic cells. KHDC3L is critical in preventing the replication associated DNA DSBs in epiblast cells (PMID: 29125140). Importantly, by analyzing KHDC3L mutations causes recurrent pregnancy loss by inducing genomic instability of human early embryonic cells (PMID: 31609975). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21790 Product name: Recombinant human C6orf221 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-217 aa of BC137160 Sequence: MDAPRRFPTLVQLMQPKAMPVEVLGHLPKRFSWFHSEFLKNPKVVRLEVWLVEKIFGRGGERIPHVQGMSQILIHVNRLDPNGEAEILVFGRPSYQEDTIKMIMNLADYHRQLQAKGSGKALAQDVATQKAETQRSSIEVREAGTQRSVEVREAGTQRSVEVQEVGTQGSPVEVQEAGTQQSLQAANKSGTQRSPEAASKAVTQRFREDARDPVTRL Predict reactive species Full Name: chromosome 6 open reading frame 221 Calculated Molecular Weight: 217 aa, 24 kDa Observed Molecular Weight: 21-24 kDa GenBank Accession Number: BC137160 Gene Symbol: KHDC3L Gene ID (NCBI): 154288 RRID: AB_2879833 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q587J8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924