Proteintech, 24991-1-AP, ZC3H12D Polyclonal antibody

Size: 20ul / 150ul The ZC3H12D (24991-1-AP) by Proteintech is a Polyclonal antibody targeting ZC3H12D in WB, IHC, IP, ELISA applications with reactivity to human samples 24991-1-AP targets ZC3H12D in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells, K-562 cells Positive IP detected in: Raji cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ZC3H12D, also named as MCP induced protein 4, is a 527 amino acid protein, which contains one C3H1-type zinc finger and belongs to the ZC3H12 family. ZC3H12D exists as three isoforms and localizes in the cytoplasm. ZC3H12D may regulate cell growth likely by suppressing RB1 phosphorylation and serves as a tumor suppressor in certain leukemia cells. ZC3H12D is expressed in normal human lymphocytes but defective in some leukemia/lymphoma cell lines. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag21770 Product name: Recombinant human ZC3H12D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-90 aa of BC157832 Sequence: MEHPSKMEFFQKLGYDREDVLRVLGKLGEGALVNDVLQELIRTGSRPGALEHPAAPRLVPRGSCGVPDSAQRGPGTALEEDFRTLASSLR Predict reactive species Full Name: zinc finger CCCH-type containing 12D Calculated Molecular Weight: 527 aa, 58 kDa Observed Molecular Weight: 55-58 kDa GenBank Accession Number: BC157832 Gene Symbol: ZC3H12D Gene ID (NCBI): 340152 RRID: AB_2879834 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A2A288 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.