Iright
BRAND / VENDOR: Proteintech

Proteintech, 25000-1-AP, SP2 Polyclonal antibody

CATALOG NUMBER: 25000-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SP2 (25000-1-AP) by Proteintech is a Polyclonal antibody targeting SP2 in WB, ELISA applications with reactivity to human, rat samples 25000-1-AP targets SP2 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, K-562 cells, C6 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information SP2 also named as Sp2 transcription factor or KIAA0048 is a 613 amino acid protein, which contains 3 C2H2-type zinc fingers and belongs to the sp1 C2H2-type zinc finger protein family. SP2 binds to box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites in nucleus . SP2 may regulate expression of the T-cell antigen receptor (TCR) gene. Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag8060 Product name: Recombinant human SP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 303-606 aa of BC016680 Sequence: QQQVVQIPQQALRVVQAASATLPTVPQKPSQNFQIQAAEPTPTQVYIRTPSGEVQTVLVQDSPPATAAATSNTTCSSPASRAPHLSGTSKKHSAAILRKERPLPKIAPAGSIISLNAAQLAAAAQAMQTININGVQVQGVPVTITNTGGQQQLTVQNVSGNNLTISGLSPTQIQLQMEQALAGETQPGEKRRRMACTCPNCKDGEKRSGEQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHARTHTGDKRFECAQCQKRFMRSDHLTKHYKTHLVTKNL Predict reactive species Full Name: Sp2 transcription factor Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC016680 Gene Symbol: SP2 Gene ID (NCBI): 6668 RRID: AB_2879839 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02086 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924