Product Description
Size: 20ul / 150ul
The hCG Alpha (25014-1-AP) by Proteintech is a Polyclonal antibody targeting hCG Alpha in WB, IHC, ELISA applications with reactivity to human samples
25014-1-AP targets hCG Alpha in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: JAR cells, human placenta tissue
Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:1000-1:4000
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag17313 Product name: Recombinant human CGA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-116 aa of BC020782 Sequence: SAPDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS Predict reactive species
Full Name: glycoprotein hormones, alpha polypeptide
Calculated Molecular Weight: 116 aa, 13 kDa
Observed Molecular Weight: 22 kDa
GenBank Accession Number: BC020782
Gene Symbol: hCG Alpha
Gene ID (NCBI): 1081
RRID: AB_2879846
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: P01215
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924