Proteintech, 25038-1-AP, FAM46C Polyclonal antibody

Size: 20ul / 150ul The FAM46C (25038-1-AP) by Proteintech is a Polyclonal antibody targeting FAM46C in ELISA applications with reactivity to human samples 25038-1-AP targets FAM46C in WB, ELISA applications and shows reactivity with human samples. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19147 Product name: Recombinant human FAM46C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-67 aa of BC131726 Sequence: MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRGNFPTLEITLKDIVQTVRSRLEEAGIKVH Predict reactive species Full Name: family with sequence similarity 46, member C Calculated Molecular Weight: 391 aa, 45 kDa GenBank Accession Number: BC131726 Gene Symbol: FAM46C Gene ID (NCBI): 54855 RRID: AB_2879863 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VWP2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.