Proteintech, 25048-1-AP, ZFAND5 Polyclonal antibody

Size: 20ul / 150ul The ZFAND5 (25048-1-AP) by Proteintech is a Polyclonal antibody targeting ZFAND5 in WB, ELISA applications with reactivity to human, mouse, rat samples 25048-1-AP targets ZFAND5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information ZFAND5 is Involved in protein degradation via the ubiquitin-proteasome system and may act by anchoring ubiquitinated proteins to the proteasome. It plays a role in ubiquitin-mediated protein degradation during muscle atrophy and in the regulation of NF-kappa-B activation and apoptosis. It can inhibit NF-kappa-B activation triggered by overexpression of RIPK1 and TRAF6 but not of RELA. It also inhibits tumor necrosis factor (TNF), IL-1, and TLR4-induced NF-kappa-B activation in a dose-dependent manner. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19311 Product name: Recombinant human ZFAND5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 75-141 aa of BC027707 Sequence: NCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITTPKTEVSEPVVTQPSPSVSQPSTSQSEE Predict reactive species Full Name: zinc finger, AN1-type domain 5 Calculated Molecular Weight: 213 aa, 23 kDa Observed Molecular Weight: 23-35 kDa GenBank Accession Number: BC027707 Gene Symbol: ZFAND5 Gene ID (NCBI): 7763 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O76080 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.