Iright
BRAND / VENDOR: Proteintech

Proteintech, 25076-1-AP, GPR107 Polyclonal antibody

CATALOG NUMBER: 25076-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GPR107 (25076-1-AP) by Proteintech is a Polyclonal antibody targeting GPR107 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 25076-1-AP targets GPR107 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse cerebellum tissue Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information GPR107 also named as KIAA1624 or LUSTR1 is 600 amino acid protein, which belongs to the LU7TM family. GPR107 localizes in membrane and is a multi-pass membrane protein. GPR107 is a promising candidate receptor for neuronostatin, and neuronostatin, interacting with GPR107, may play an important role in the central control of cardiovascular function. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18649 Product name: Recombinant human GPR107 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 41-260 aa of BC110518 Sequence: VHHLALKDDVRHKVHLNTFGFFKDGYMVVNVSSLSLNEPEDKDVTIGFSLDRTKNDGFSSYLDEDVNYCILKKQSVSVTLLILDISRSEVRVKSPPEAGTQLPKIIFSRDEKVLGQSQEPNVNPASAGNQTQKTQDGGKSKRSTVDSKAMGEKSFSVHNNGGAVSFQFFFNISTDDQEGLYSLYFHKCLGKELPSDKFTFSLDIEITEKNPDSYLSAGEI Predict reactive species Full Name: G protein-coupled receptor 107 Calculated Molecular Weight: 552 aa, 67 kDa Observed Molecular Weight: 60-67 kDa GenBank Accession Number: BC110518 Gene Symbol: GPR107 Gene ID (NCBI): 57720 RRID: AB_2879886 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VW38 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924