Iright
BRAND / VENDOR: Proteintech

Proteintech, 25085-1-AP, NPSR1 Polyclonal antibody

CATALOG NUMBER: 25085-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NPSR1 (25085-1-AP) by Proteintech is a Polyclonal antibody targeting NPSR1 in IHC, ELISA applications with reactivity to human samples 25085-1-AP targets NPSR1 in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon cancer tissue, human cervical cancer tissue, human endometrial cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Neuropeptide S receptor 1 (NPSR1), previously known as GPRA and GPR154, is a G protein-coupled receptor (GPCR) that plays a significant role in various physiological processes. NPSR1 is primarily expressed in the bronchus, brain, and immune cells. It is also found in specific peripheral cell types such as monocytes/macrophages and neuroendocrine cells of the gut (PMID: 30711025). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18785 Product name: Recombinant human NPSR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-52 aa of BC132693 Sequence: MPANFTEGSFDSSGTGQTLDSSPVACTETVTFTEVVEGKEWGSFYYSFKTEQ Predict reactive species Full Name: neuropeptide S receptor 1 Calculated Molecular Weight: 371 aa, 43 kDa GenBank Accession Number: BC132693 Gene Symbol: NPSR1 Gene ID (NCBI): 387129 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6W5P4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924