Iright
BRAND / VENDOR: Proteintech

Proteintech, 25090-1-AP, PCDH9 Polyclonal antibody

CATALOG NUMBER: 25090-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCDH9 (25090-1-AP) by Proteintech is a Polyclonal antibody targeting PCDH9 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 25090-1-AP targets PCDH9 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information Protocadherin-9 (PCDH9) is a member of the protocadherin family that belongs to the cadherin superfamily. Protocadherins are calcium-dependent adhesion proteins and have been implicated in neural cell-cell interactions. They are abundantly expressed in the central nervous system during embryonic development and in adulthood (PMID: 24214103). PCDH9 is a single-pass type I membrane protein that contains seven cadherin motifs in its extracellular domain. It might be involved in the formation of specific neural circuits during neural development (PMID: 22982106).What is the molecular weight of PCDH9?The calculated molecular weight of PCDH9 is 136 kDa.What are the isoforms of PCDH9?Alternatively spliced transcript variants encoding distinct isoforms have been identified for the PCDH9 gene; a short transcript, a standard transcript, a transcript with additional exon 2, and another transcript with variant exon 3 (PMID: 15095963).What is PCDH9's involvement in neural development?The family of protocadherins is essential for neural development as mutations in these proteins give rise to neurodevelopmental disorders such as schizophrenia and epilepsy. However, the exact mechanisms of loss of function and the role of PCDH9 remain to be fully characterized (PMID: 22982106). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18696 Product name: Recombinant human PCDH9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1146-1237 aa of BC136626 Sequence: PGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGSNEGHFNNGSHMTDIPLANLKSYKQAGGATESPKEHQL Predict reactive species Full Name: protocadherin 9 Calculated Molecular Weight: 1237 aa, 136 kDa Observed Molecular Weight: 150-180 kDa GenBank Accession Number: BC136626 Gene Symbol: PCDH9 Gene ID (NCBI): 5101 RRID: AB_2879891 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HC56 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924