Proteintech, 25101-1-AP, WFDC12 Polyclonal antibody

Size: 20ul / 150ul The WFDC12 (25101-1-AP) by Proteintech is a Polyclonal antibody targeting WFDC12 in IHC, ELISA applications with reactivity to human samples 25101-1-AP targets WFDC12 in WB, IF, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human lung cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18795 Product name: Recombinant human WFDC12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 34-111 aa of BC146514 Sequence: CPADNVRCFKSDPPQCHTDQDCLGERKCCYLHCGFKCVIPVKELEEGGNKDEDVSRPYPEPGWEAKCPGSSSTRCPQK Predict reactive species Full Name: WAP four-disulfide core domain 12 Calculated Molecular Weight: 111 aa, 12 kDa GenBank Accession Number: BC146514 Gene Symbol: WFDC12 Gene ID (NCBI): 128488 RRID: AB_2879897 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WWY7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.