Proteintech, 25104-1-AP, MYO16 Polyclonal antibody

Size: 20ul / 150ul The MYO16 (25104-1-AP) by Proteintech is a Polyclonal antibody targeting MYO16 in WB, ELISA applications with reactivity to human, rat samples 25104-1-AP targets MYO16 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information MYO16, also named as KIAA0865, MYO16B, is actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Their highly divergent tails are presumed to bind to membranous compartments, which would be moved relative to actin filaments. MYO16 may be involved in targeting of the catalytic subunit of protein phosphatase 1 during brain development. The antibody can recognize isoform1, isoform2 and isoform3 of MYO16. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18798 Product name: Recombinant human MYO16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 226-410 aa of BC146791 Sequence: LHMACASGYKEVVSLILEHGGDLNIVDDQYWTPLHLAAKYGQTNLVKLLLMHQANPHLVNCNEEKASDIAASEFIEEMLLKAEIAWEEKMKEPLSASTLAQEEPYEEIIHDLPVLSSKLSPLVLPIAKQDSLLEKDIMFKDATKGLCKQQSQDSIPENPMMSGSTKPEQVKLMPPAPNDDLATLS Predict reactive species Full Name: myosin XVI Calculated Molecular Weight: 1858 aa, 206 kDa Observed Molecular Weight: 200-240 kDa GenBank Accession Number: BC146791 Gene Symbol: MYO16 Gene ID (NCBI): 23026 RRID: AB_2879898 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6X6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.