Proteintech, 25114-1-AP, POU3F4 Polyclonal antibody

Size: 20ul / 150ul The POU3F4 (25114-1-AP) by Proteintech is a Polyclonal antibody targeting POU3F4 in WB, ELISA applications with reactivity to human, mouse samples 25114-1-AP targets POU3F4 in WB, IF, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: fetal human brain tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information OTF9 also named as BRN4 and POU3F4, belongs to the POU transcription factor family and Class-3 subfamily. OTF9 is a transcription factor which exerts its primary action widely during early neural development and in a very limited set of neurons in the mature brain. Mutation of OTF9 will cause of X-linked deafness type 3 (DFN3). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18925 Product name: Recombinant human POU3F4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-181 aa of BC146551 Sequence: SILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSSTLATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFTVSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQ Predict reactive species Full Name: POU class 3 homeobox 4 Calculated Molecular Weight: 361 aa, 39 kDa Observed Molecular Weight: 40-45 kDa GenBank Accession Number: BC146551 Gene Symbol: POU3F4 Gene ID (NCBI): 5456 RRID: AB_2879903 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49335 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.