Iright
BRAND / VENDOR: Proteintech

Proteintech, 25116-1-AP, GALP Polyclonal antibody

CATALOG NUMBER: 25116-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GALP (25116-1-AP) by Proteintech is a Polyclonal antibody targeting GALP in WB, ELISA applications with reactivity to human samples 25116-1-AP targets GALP in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18928 Product name: Recombinant human GALP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-116 aa of BC148722 Sequence: LGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS Predict reactive species Full Name: galanin-like peptide Calculated Molecular Weight: 116 aa, 13 kDa Observed Molecular Weight: 5 kDa GenBank Accession Number: BC148722 Gene Symbol: GALP Gene ID (NCBI): 85569 RRID: AB_2879904 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UBC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924