Iright
BRAND / VENDOR: Proteintech

Proteintech, 25118-1-AP, DNAJB13 Polyclonal antibody

CATALOG NUMBER: 25118-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DNAJB13 (25118-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJB13 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, canine samples 25118-1-AP targets DNAJB13 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, canine samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis Positive IHC detected in: mouse testis tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat, canine Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18934 Product name: Recombinant human DNAJB13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 204-316 aa of BC153176 Sequence: PNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT Predict reactive species Full Name: DnaJ (Hsp40) related, subfamily B, member 13 Calculated Molecular Weight: 316 aa, 36 kDa Observed Molecular Weight: 32-36 kDa GenBank Accession Number: BC153176 Gene Symbol: DNAJB13 Gene ID (NCBI): 374407 RRID: AB_2879906 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P59910 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924