Iright
BRAND / VENDOR: Proteintech

Proteintech, 25119-1-AP, AWAT2 Polyclonal antibody

CATALOG NUMBER: 25119-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AWAT2 (25119-1-AP) by Proteintech is a Polyclonal antibody targeting AWAT2 in WB, ELISA applications with reactivity to human, mouse, rat samples 25119-1-AP targets AWAT2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18936 Product name: Recombinant human AWAT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 150-310 aa of BC153070 Sequence: LREYVMSTGACSVSRSSIDFLLTHKGTGNMVIVVIGGLAECRYSLPGSSTLVLKNRSGFVRMALQHGVPLIPAYAFGETDLYDQHIFTPGGFVNRFQKWFQSMVHIYPCAFYGRGFTKNSWGLLPYSRPVTTIVGEPLPMPKIENPSQEIVAKYHTLYIDA Predict reactive species Full Name: acyl-CoA wax alcohol acyltransferase 2 Calculated Molecular Weight: 333 aa, 38 kDa Observed Molecular Weight: 38-42 kDa GenBank Accession Number: BC153070 Gene Symbol: AWAT2 Gene ID (NCBI): 158835 RRID: AB_2879907 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6E213 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924