Iright
BRAND / VENDOR: Proteintech

Proteintech, 25120-1-AP, TPTE2 Polyclonal antibody

CATALOG NUMBER: 25120-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TPTE2 (25120-1-AP) by Proteintech is a Polyclonal antibody targeting TPTE2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 25120-1-AP targets TPTE2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: L02 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: L02 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19169 Product name: Recombinant human TPTE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-62 aa of BC128146 Sequence: MNESPQTNEFKGTTEEAPAKESPHTSEFKGAALVSPISKSMLERLSKFEVEDAENVASYEWT Predict reactive species Full Name: transmembrane phosphoinositide 3-phosphatase and tensin homolog 2 Calculated Molecular Weight: 522 aa, 61 kDa Observed Molecular Weight: 38-60 kDa GenBank Accession Number: BC128146 Gene Symbol: TPTE2 Gene ID (NCBI): 93492 RRID: AB_2879908 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6XPS3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924