Proteintech, 25131-1-AP, AQP7 Polyclonal antibody

Size: 20ul / 150ul The AQP7 (25131-1-AP) by Proteintech is a Polyclonal antibody targeting AQP7 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 25131-1-AP targets AQP7 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, mouse testis tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AQP7 is a member of the aquaporin family of water-selective membrane channels, localizes to the plasma membrane, and allows movement of water, glycerol and urea across cell membranes. AQP7 forms a channel that mediates water and glycerol transport across cell membranes at neutral pH. AQP7 is highly expressed in the adipose tissue(PMID: 9405233). Specification Tested Reactivity: human, mouse Cited Reactivity: mouse, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17945 Product name: Recombinant human AQP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 68-122 aa of BC062701 Sequence: LAAATIYSLFYTAILHFSGGQLMVTGPVATAGIFATYLPDHMTLWRGFLNEAWLT Predict reactive species Full Name: aquaporin 7 Calculated Molecular Weight: 342 aa, 37 kDa Observed Molecular Weight: 25-30 kDa, 40 kDa GenBank Accession Number: BC062701 Gene Symbol: AQP7 Gene ID (NCBI): 364 RRID: AB_2879913 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14520 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.