Proteintech, 25156-1-AP, EFCAB2 Polyclonal antibody

Size: 20ul / 150ul The EFCAB2 (25156-1-AP) by Proteintech is a Polyclonal antibody targeting EFCAB2 in WB, ELISA applications with reactivity to human, mouse samples 25156-1-AP targets EFCAB2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18372 Product name: Recombinant human EFCAB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-162 aa of BC005357 Sequence: MADEKDREEIIVAEFHKKIKEAFEVFDHESNNTVDVREIGTIIRSLGCCPTEGELHDLIAEVEEEEPTGYIRFEKFLPVMTEILLERKYRPIPEDVLLRAFEVLDSAKRGFLTKDELIKYMTEEGEPFSQEEMEEMLSAAIDPESNSINYKDYITMMVIDEN Predict reactive species Full Name: EF-hand calcium binding domain 2 Calculated Molecular Weight: 162 aa, 19 kDa Observed Molecular Weight: 19 kDa GenBank Accession Number: BC005357 Gene Symbol: EFCAB2 Gene ID (NCBI): 84288 RRID: AB_2879930 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5VUJ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.