Proteintech, 25162-1-AP, DNAJC18 Polyclonal antibody

Size: 20ul / 150ul The DNAJC18 (25162-1-AP) by Proteintech is a Polyclonal antibody targeting DNAJC18 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 25162-1-AP targets DNAJC18 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, A431 cells, HepG2 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information DnaJC18, also named as DnaJ (Hsp40) homolog, subfamily C, member 21, belongs to Type III DnaJ Family. Type III DnaJ proteins have a J domain but lack the other sequence features that are found in type I and II members of the family. DnaJC18 might play a role in the process of spermatogenesis in adult testis (PMID: 29082339). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18498 Product name: Recombinant human DNAJC18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 196-358 aa of BC030162 Sequence: TDDTYYYRRRHRHERTQTQKEEEEEKPQTTYSAFIQLLPVLVIVIISVITQLLATNPPYSLFYKSTLGYTISRETQNLQVPYFVDKNFDKAYRGASLHDLEKTIEKDYIDYIQTSCWKEKQQKSELTNLAGLYRDERLKQKAESLKLENCEKLSKLIGLRRGG Predict reactive species Full Name: DnaJ (Hsp40) homolog, subfamily C, member 18 Calculated Molecular Weight: 358 aa, 42 kDa Observed Molecular Weight: 39-42 kDa GenBank Accession Number: BC030162 Gene Symbol: DNAJC18 Gene ID (NCBI): 202052 RRID: AB_2918087 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H819 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.