Iright
BRAND / VENDOR: Proteintech

Proteintech, 25163-1-AP, FAM40B Polyclonal antibody

CATALOG NUMBER: 25163-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM40B (25163-1-AP) by Proteintech is a Polyclonal antibody targeting FAM40B in WB, ELISA applications with reactivity to human, mouse, rat samples 25163-1-AP targets FAM40B in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse testis tissue, rat testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information FAM40B, also known as STRIP2, is a member of the striatin-interacting phosphatase and kinase (STRIPAK) complex that is involved in the regulation of various processes such as cell proliferation and differentiation. Fam40b in ESCs is as a perinuclear and nucleolar protein with a molecular weight of 96kDa (PMID: 25010986). The expression of Fam40b is essential for the lineage commitment of murine embryonic stem cells (mESCs) into differentiated somatic cells via mechanisms involving pluripotency and epigenetic networks. Catalog#17293-1-AP specially recognises the 96 kDa protein. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18230 Product name: Recombinant human FAM40B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 268-413 aa of BC019064 Sequence: KVLLLLWKVVMFTLGGFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLTKQDSLDIYNERDLFKTEEPATEEEEESAGDGERTLDGELDLLEQDPLVPPPPSQAPLSAERVA Predict reactive species Full Name: family with sequence similarity 40, member B Calculated Molecular Weight: 834 aa, 95 kDa Observed Molecular Weight: 95-100 kDa GenBank Accession Number: BC019064 Gene Symbol: FAM40B Gene ID (NCBI): 57464 RRID: AB_2879933 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9ULQ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924