Iright
BRAND / VENDOR: Proteintech

Proteintech, 25179-1-AP, HYAL1 Polyclonal antibody

CATALOG NUMBER: 25179-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HYAL1 (25179-1-AP) by Proteintech is a Polyclonal antibody targeting HYAL1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25179-1-AP targets HYAL1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, HepG2 cells, MCF-7 cells Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Hyaluronic acid (HA) is a glycosaminoglycan that is believed to have numerous important biologic functions, including modulation of cell proliferation, migration, and differentiation, as well as the regulation of extracellular water and protein homeostasis. It is also an integral structural component of cartilage and other tissues and acts as a lubricant in joints. Hyaluronidases are a family of enzymes that catalyse the degradation of HA. In humans, there are five functional hyaluronidases: HYAL1, HYAL2, HYAL3, HYAL4 and HYAL5 (also known as SPAM1 or PH-20); plus a pseudogene, HYAL6 (also known as HYALP1). HYAL-1 is present in many tissues and is predominantly found in the plasma and urine (PMID: 16600643). In addition to its function in normal cellular hyaluronan turnover, human HYAL-1 is implicated in cancer proliferation, angiogenesis, and inflammatory diseases (PMID: 17503783). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag17943 Product name: Recombinant human HYAL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 131-435 aa of BC035695 Sequence: EAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRCYPGWQAPWCERKSMW Predict reactive species Full Name: hyaluronoglucosaminidase 1 Calculated Molecular Weight: 435 aa, 48 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC035695 Gene Symbol: HYAL1 Gene ID (NCBI): 3373 RRID: AB_2879945 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q12794 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924