Proteintech, 25202-1-AP, ANKRD33 Polyclonal antibody

Size: 20ul / 150ul The ANKRD33 (25202-1-AP) by Proteintech is a Polyclonal antibody targeting ANKRD33 in WB, IHC, ELISA applications with reactivity to human samples 25202-1-AP targets ANKRD33 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Y79 cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Ankyrin repeat domain 33 (ANKRD33), also named as C12orf7, belongs to the ankyrin repeat family and is highly expressed in retina. ANKRD33 exists as two isoforms. The isoform 1 molecular weight is 29kDa and isoform 2 is 49kDa. The function of ANKRD33 is still non-known. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18582 Product name: Recombinant human ANKRD33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 73-272 aa of BC121153 Sequence: AMRNRCECVATLLMAGADLTAVDPVRGKTALEWAVLTDSFDTVWRIRQLLRRPQVEQLSQHYKPEWPALSGLVAQAQAQAQVAPSLLERLQATLSLPFAPSPQEGGVLDHLVTATTSLASPFVTTACHTLCPDHPPSLGTRSKSVPELLVPAEAQSFRTPKSGPSSLAIPGAQDREEETGGGGQNGTEVGEDGIGQAGNR Predict reactive species Full Name: ankyrin repeat domain 33 Calculated Molecular Weight: 452 aa, 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC121153 Gene Symbol: ANKRD33 Gene ID (NCBI): 341405 RRID: AB_2879956 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z3H0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.