Iright
BRAND / VENDOR: Proteintech

Proteintech, 25204-1-AP, WIPI1 Polyclonal antibody

CATALOG NUMBER: 25204-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WIPI1 (25204-1-AP) by Proteintech is a Polyclonal antibody targeting WIPI1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25204-1-AP targets WIPI1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SW 1990 cells, HEK-293 cells, NIH/3T3 cells Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information WIPI1, or WD repeat domain, phosphoinositide-interacting protein 1, is a member of the WD40 repeat family of proteins, which are key components of many essential biological functions. WIPI1 is involved in the regulation of autophagy, a cellular process critical for maintaining cellular integrity and recycling intracellular proteins, lipids, and organelles. WIPI1 is characterized by its 7-bladed β-propeller structure and contains a conserved motif for interaction with phospholipids, specifically binding to phosphoinositides. This interaction is crucial for its function in autophagy, where it acts as an effector of phosphatidylinositol 3-phosphate (PtdIns3P). WIPI1 and WIPI2 are among the first proteins to be recruited during autophagy, with WIPI2 interacting with components of the ULK1/2 complex and PtdIns3P, tethering the phagophore to the endoplasmic reticulum (ER). WIPI1 supports the function of WIPI2 in recruiting the ATG16L complex, which is essential for LC3 lipidation and autophagosome formation. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18461 Product name: Recombinant human WIPI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 346-446 aa of BC039867 Sequence: QDGGECVLIKTHSLLGSGTTEENKENDLRPSLPQSYAATVARPSASSASTVPGYSEDGGALRGEVIPEHEFATGPVCLDDENEFPPIILCRGNQKGKTKQS Predict reactive species Full Name: WD repeat domain, phosphoinositide interacting 1 Calculated Molecular Weight: 446 aa, 49 kDa Observed Molecular Weight: 49 kDa GenBank Accession Number: BC039867 Gene Symbol: WIPI1 Gene ID (NCBI): 55062 RRID: AB_2879958 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5MNZ9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924