Proteintech, 25212-1-AP, JIP3 Polyclonal antibody

Size: 20ul / 150ul The JIP3 (25212-1-AP) by Proteintech is a Polyclonal antibody targeting JIP3 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 25212-1-AP targets JIP3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19561 Product name: Recombinant human JIP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 171-248 aa of BC137123 Sequence: MIQTYVEHIERSKMQQVGGNSQTESSLPGRRKERPTSLNVFPLADGTVRAQIGGKLVPAGDHWHLSDLGQLQSSSSYQ Predict reactive species Full Name: mitogen-activated protein kinase 8 interacting protein 3 Calculated Molecular Weight: 1336 aa, 147 kDa Observed Molecular Weight: 147 kDa GenBank Accession Number: BC137123 Gene Symbol: JIP3 Gene ID (NCBI): 23162 RRID: AB_2879962 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UPT6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.