Iright
BRAND / VENDOR: Proteintech

Proteintech, 25214-1-AP, ZKSCAN1 Polyclonal antibody

CATALOG NUMBER: 25214-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZKSCAN1 (25214-1-AP) by Proteintech is a Polyclonal antibody targeting ZKSCAN1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse samples 25214-1-AP targets ZKSCAN1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, MCF-7 cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information ZKSCAN1(Zinc finger protein with KRAB and SCAN domains 1), also named as ZNF139, is a member in transcription factor zinc finger protein family(PMID: 24515389). Zinc finger protein 139 (ZNF139) gene is proved play an important role in gastric cancer, overexpression of ZNF139 correlated with tumor differentiation, invasion depth, clinical stage, lymphatic metastasis, and blood vessel invasion(PMID: 25436386, PMID: 25561801). The molecular weight of ZKSCAN1 is 64 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19721 Product name: Recombinant human ZKSCAN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-382 aa of BC022378 Sequence: DLHHEATQSHFKHSSRKPRLLQSRALPAAHIPAPPHEGSPRDQAMASALFTADSQAMVKIEDMAVSLILEEWGCQNLARRNLSRDNRQENYGSAFPQGGENRNENEESTSKAETSEDSASRGETTGRSQKEFGEKRDQEGKTGERQQKNPEEKTRKEKRDSGPAIGKDKKTITGERGPREKGKGLGRSFSLSSNFTTPEEVPTGTKSHRCDEC Predict reactive species Full Name: zinc finger with KRAB and SCAN domains 1 Calculated Molecular Weight: 563 aa, 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC022378 Gene Symbol: ZKSCAN1 Gene ID (NCBI): 7586 RRID: AB_2879963 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P17029 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924