Iright
BRAND / VENDOR: Proteintech

Proteintech, 25223-1-AP, UCP5 Polyclonal antibody

CATALOG NUMBER: 25223-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UCP5 (25223-1-AP) by Proteintech is a Polyclonal antibody targeting UCP5 in WB, ELISA applications with reactivity to human samples 25223-1-AP targets UCP5 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information UCP5, also known as BMCP1 (brain mitochondrial carrier protein-1), is a member of uncoupling proteins (UCPs) that catalyze proton leaks across the inner mitochondrial membrane, thus uncoupling fuel oxidation from ATP synthesis. UCPs are implicated in metabolic rate and adaptational thermoregulation. UCP5 is widely expressed with high abundance in brain and testis. Alternative splicing generates several isoforms of UCP5. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18661 Product name: Recombinant human SLC25A14 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-111 aa of BC119666 Sequence: GIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFPVDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPAL Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier, brain), member 14 Calculated Molecular Weight: 325 aa, 36 kDa Observed Molecular Weight: 36-40 kDa GenBank Accession Number: BC119666 Gene Symbol: UCP5 Gene ID (NCBI): 9016 RRID: AB_2879971 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95258 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924