Iright
BRAND / VENDOR: Proteintech

Proteintech, 25244-1-AP, PHLPP2 Polyclonal antibody

CATALOG NUMBER: 25244-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PHLPP2 (25244-1-AP) by Proteintech is a Polyclonal antibody targeting PHLPP2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 25244-1-AP targets PHLPP2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, NIH/3T3 cells Positive IP detected in: HeLa cells Positive IHC detected in: human colon cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information PHLPP2 also named as PHLPPL is a 1323 amino acid protein, which contains 22 LRR repeats, 1 PH domain and 1 PP2C-like domain. Localized to both the nucleus and the cytoplasm, PHLPPL uses manganese as a cofactor and mediates the dephosphorylation of Akt1, thereby playing a role in cell survival and apoptotic regulation. Multiple isoforms of PHLPPL exist due to alternative splicing events. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag19000 Product name: Recombinant human PHLPPL protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 575-781 aa of BC129927 Sequence: LDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLLYLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVTS Predict reactive species Full Name: PH domain and leucine rich repeat protein phosphatase-like Calculated Molecular Weight: 1323 aa, 147 kDa Observed Molecular Weight: 147 kDa GenBank Accession Number: BC129927 Gene Symbol: PHLPPL Gene ID (NCBI): 23035 RRID: AB_2879985 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZVD8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924