Iright
BRAND / VENDOR: Proteintech

Proteintech, 25274-1-AP, FAM98C Polyclonal antibody

CATALOG NUMBER: 25274-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM98C (25274-1-AP) by Proteintech is a Polyclonal antibody targeting FAM98C in WB, ELISA applications with reactivity to human samples 25274-1-AP targets FAM98C in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Background Information FAM98C has two isoforms with MW 28-30 kDa and 37-40 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag15042 Product name: Recombinant human FAM98C protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 153-286 aa of BC034383 Sequence: MVQELDLTLQALGLPRPAPGTPASQLLQELHAKISELQPSLPPGSLQPLLSCSLDAPRWEALESLSQSLRDQYRCRRCLLLKRLDLTTSAFHWSDRAEAQGEAMRAVLIPIREVLTPESDISIAHVLAARADLS Predict reactive species Full Name: family with sequence similarity 98, member C Calculated Molecular Weight: 349 aa, 37 kDa Observed Molecular Weight: 37 kDa, 28 kDa GenBank Accession Number: BC034383 Gene Symbol: FAM98C Gene ID (NCBI): 147965 RRID: AB_2879999 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q17RN3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924