Product Description
Size: 20ul / 150ul
The UPK1A (25275-1-AP) by Proteintech is a Polyclonal antibody targeting UPK1A in IP, IHC, ELISA applications with reactivity to human, mouse, rat samples
25275-1-AP targets UPK1A in IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IP detected in: mouse bladder tissue
Positive IHC detected in: human bladder tissue, rat bladder tissue, mouse bladder tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC): IHC : 1:2500-1:10000
Background Information
Uroplakins are a group of urothelial differentiation-related membrane proteins. They are components of the asymmetric unit membrane (AUM), which forms the apical plaques of mammalian urothelium and is believed to play a role in strengthening the urothelial apical surface thus preventing the cells from rupturing during bladder distention (PMID: 8175808). Uroplakin-1a (UPK1A) belongs to the tetraspanin (TM4SF) family. UPK1A plays an important role in normal bladder epithelial physiology, possibly in regulating membrane permeability of superficial umbrella cells or in stabilizing the apical membrane.
Specification
Tested Reactivity: human, mouse, rat
Cited Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag17356 Product name: Recombinant human UPK1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 111-230 aa of BC107098 Sequence: CITSYTHRDYMVSNPSLITKQMLTFYSADTDQGQELTRLWDRVMIEQECCGTSGPMDWVNFTSAFRAATPEVVFPWPPLCCRRTGNFIPLNEEGCRLGHMDYLFTKGCFEHIGHAIDSYT Predict reactive species
Full Name: uroplakin 1A
Calculated Molecular Weight: 258 aa, 29 kDa
Observed Molecular Weight: 29 kDa
GenBank Accession Number: BC107098
Gene Symbol: UPK1A
Gene ID (NCBI): 11045
RRID: AB_2880000
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O00322
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924