Iright
BRAND / VENDOR: Proteintech

Proteintech, 25281-1-AP, BEX5 Polyclonal antibody

CATALOG NUMBER: 25281-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BEX5 (25281-1-AP) by Proteintech is a Polyclonal antibody targeting BEX5 in IHC, ELISA applications with reactivity to human, mouse samples 25281-1-AP targets BEX5 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse brain tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information The Brain-Expressed X-linked (BEX) family proteins are comprised of five human proteins including BEX1, BEX2, BEX3, BEX4, and BEX5. While human BEX5 is widely expressed in many tissues, BEX5 has not been studied well (PMID: 26408910). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16446 Product name: Recombinant human BEX5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-65 aa of BC106955 Sequence: MENVPKENKVVEKAPVQNEAPALGGGEYQEPGGNVKGVWAPPAPGFGEDVPNRLVDNIDMIDGDG Predict reactive species Full Name: brain expressed, X-linked 5 Calculated Molecular Weight: 111 aa, 13 kDa GenBank Accession Number: BC106955 Gene Symbol: BEX5 Gene ID (NCBI): 340542 RRID: AB_3085780 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q5H9J7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924