Iright
BRAND / VENDOR: Proteintech

Proteintech, 25282-1-AP, TRAPPC2L Polyclonal antibody

CATALOG NUMBER: 25282-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRAPPC2L (25282-1-AP) by Proteintech is a Polyclonal antibody targeting TRAPPC2L in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 25282-1-AP targets TRAPPC2L in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, U-251 cells, NIH/3T3 cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag16890 Product name: Recombinant human TRAPPC2L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-140 aa of BC105809 Sequence: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKALVDQRELYLGLLYPTEDYKVYGYVTNSKVKFVMVVDSSNTALRDNEIRSMFRKLHNSYTDVMCNPFYNPGDRIQSSRAFDNMVTSMMIQVC Predict reactive species Full Name: trafficking protein particle complex 2-like Calculated Molecular Weight: 140 aa, 16 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC105809 Gene Symbol: TRAPPC2L Gene ID (NCBI): 51693 RRID: AB_2880006 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UL33 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924