Iright
BRAND / VENDOR: Proteintech

Proteintech, 25289-1-AP, C8A Polyclonal antibody

CATALOG NUMBER: 25289-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The C8A (25289-1-AP) by Proteintech is a Polyclonal antibody targeting C8A in WB, ELISA applications with reactivity to human samples 25289-1-AP targets C8A in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information C8 is a component of the complement system and contains three polypeptides, alpha, beta and gamma. Complement component C8 alpha chain (C8A) is a constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells. C8A inserts into the target membrane, but does not form pores by itself. Mutations in the C8A gene cause complement C8 alpha-gamma deficiency. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18389 Product name: Recombinant human C8A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 31-383 aa of BC132913 Sequence: AATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQ Predict reactive species Full Name: complement component 8, alpha polypeptide Calculated Molecular Weight: 584 aa, 65 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC132913 Gene Symbol: C8A Gene ID (NCBI): 731 RRID: AB_3085781 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P07357 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924