Iright
BRAND / VENDOR: Proteintech

Proteintech, 25291-1-AP, CLCA1 Polyclonal antibody

CATALOG NUMBER: 25291-1-AP
Regular price$0.99
/
Shipping calculated at checkout.
  • In stock, ready to ship

  • Backordered, shipping soon

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CLCA1 (25291-1-AP) by Proteintech is a Polyclonal antibody targeting CLCA1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 25291-1-AP targets CLCA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: COLO 320 cells, mouse colon tissue, mouse lung tissue Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Calcium-activated chloride channel regulator 1(CLCA1) is a secreted protein, and it has an N-terminal zinc-dependent metallohydrolase domain with a conserved HExxE catalytic motif similar to that found in matrix metalloproteases (MMPs), and "a Disintegrin and metalloproteases" (ADAMs). The only known substrate for CLCA1 is CLCA1 itself as it undergoes intracellular autocatalytic cleavage resulting in two cleavage products which are both secreted. Since a previous study suggested that a band around 75 kDa, corresponding to the N-terminal autocatalytic cleavage product, was observed in mucus from both human and WT mice. In addition, an additional band at 50 kDa was identified in human and WT mouse mucus, suggesting that CLCA1 can be further processed. However, no band corresponding to the full-length un-cleaved CLCA1 could be detected in the human samples, and only a very faint band was observed in WT mouse mucus, indicating that most of the CLCA1 that is secreted into the mucus is fully cleaved in vivo. (PMID: 29885864) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18176 Product name: Recombinant human CLCA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 715-914 aa of BC156805 Sequence: EINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAPGDDYDHGTAHKYIIRISTSILDLRDKFNESLQVNTTALIPKEANSEEVFLFKPENITFENGTDLFIAIQAVDKVDLKSEISNIARVSLFIPPQTPPETPSPDETSAPCPNIHINSTIPGIHILKIMWKWIGELQLSIA Predict reactive species Full Name: chloride channel accessory 1 Calculated Molecular Weight: 914 aa, 100 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC156805 Gene Symbol: CLCA1 Gene ID (NCBI): 1179 RRID: AB_3085782 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A8K7I4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924