Proteintech, 25295-1-AP, PPFIA4 Polyclonal antibody

Size: 20ul / 150ul The PPFIA4 (25295-1-AP) by Proteintech is a Polyclonal antibody targeting PPFIA4 in IHC, ELISA applications with reactivity to human, mouse, rat samples 25295-1-AP targets PPFIA4 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Protein tyrosine phosphatase receptor type F polypeptide interacting protein alpha 4 (PPFIA4), also named as Liprin alpha 4, belongs to the liprin family and Liprin-alpha subfamily. PPFIA4 has been reported as a new potential therapeutic target for refractory pancreatic cancer, small cell lung cancer, and clear cell renal cell cancer (PMID: 35382861). As a glycolysis-related oncogene, PPFIA4 is also a potential biomarker of colon cancer (PMID: 34094943). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18130 Product name: Recombinant human PPFIA4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-78 aa of BC132925 Sequence: MGSAADVRFSLGTTTHAPPGVHRRYSALREESAKDWETSPLPGMLAPAAGPAFDSDPEISDVDEDEPGGLVGSADVVS Predict reactive species Full Name: protein tyrosine phosphatase, receptor type, f polypeptide (PTPRF), interacting protein (liprin), alpha 4 Calculated Molecular Weight: 701 aa, 78 kDa GenBank Accession Number: BC132925 Gene Symbol: PPFIA4 Gene ID (NCBI): 8497 RRID: AB_3085783 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75335 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.