Proteintech, 25296-1-AP, Claudin 23 Polyclonal antibody

Size: 20ul / 150ul The Claudin 23 (25296-1-AP) by Proteintech is a Polyclonal antibody targeting Claudin 23 in WB, IHC, ELISA applications with reactivity to human samples 25296-1-AP targets Claudin 23 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: COLO 320 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Claudin 23 (CLDN23) belongs to the large claudin family of proteins, which are tetraspan transmembrane proteins of tight junctions (PMID: 12736707; 18036336). Claudins exhibit specific patterns of expression in different tissues. Human CLDN23 mRNA was expressed in germinal center B cells, placenta, stomach as well as in colon tumor (PMID: 12736707). CLDN23 has been reported as a candidate tumor suppressor gene implicated in intestinal-type gastric cancer (PMID: 12736707). Specification Tested Reactivity: human Cited Reactivity: human, canine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18189 Product name: Recombinant human CLDN23 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-292 aa of BC125148 Sequence: WCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL Predict reactive species Full Name: claudin 23 Calculated Molecular Weight: 292 aa, 32 kDa Observed Molecular Weight: 32 kDa GenBank Accession Number: BC125148 Gene Symbol: Claudin 23 Gene ID (NCBI): 137075 RRID: AB_2880013 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96B33 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.