Proteintech, 25318-1-AP, Desmoplakin Polyclonal antibody

Size: 20ul / 150ul The Desmoplakin (25318-1-AP) by Proteintech is a Polyclonal antibody targeting Desmoplakin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 25318-1-AP targets Desmoplakin in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, HepG2 cells, mouse heart tissue, BxPC-3 cells, HEK-293 cells Positive IP detected in: BxPC-3 cells Positive IHC detected in: rat heart tissue, human normal colon, human bowen disease, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Positive FC (Intra) detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:2500-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:750-1:3000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information The desmoplakin (DP) is the most abundant desmosomal proteins and is located at the cytoplasmic portion of the desmosomes which are specialized cell-cell adhesion structures abundant in tissues such as muscle and epidermis that are subjected to mechanical stress. Desmoplakin 1 and 2 (DP 1 and 2) are two splice variants sharing common C-terminal and N-terminal globular head and tail domains, but differ in the length of the rod domain that links them. This antibody detects both DP1 (280-330 kDa) and DP2 (240-260 kDa). (PMID: 16467215, 11781569) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18065 Product name: Recombinant human DSP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC140802 Sequence: MSCNGGSHPRINTLGRMIRAESGPDLRYEVTSGGGGTSRMYYSRRGVITDQNSDGYCQTGTMSRHQNQNTIQELLQNCSDCLMRAELIVQPELKYGDGIQLTRSRELDECFAQANDQMEILDSLIREMRQMGQPCDAYQKRLLQLQEQMRALYKAISVPRVRRASSKGGGGYTCQSGSGWDEFTKHVTSECLGWMRQQRAEMDMVAWGVDLASVEQHINSHRGIHNSIGDYRWQLDKIKADLREKSAIYQLEEEYENLLKASFERMDHLRQLQNIIQATSREIMWINDCEEEELLYDWSDKNTNIAQKQEAFSIRMSQLEVKEKELNKLKQESDQLVLNQHPASDKIEAY Predict reactive species Full Name: desmoplakin Calculated Molecular Weight: 2871 aa, 332 kDa Observed Molecular Weight: 240-330 kDa GenBank Accession Number: BC140802 Gene Symbol: DSP Gene ID (NCBI): 1832 RRID: AB_2880028 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P15924 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.