Proteintech, 25326-1-AP, DYNC1LI1 Polyclonal antibody

Size: 20ul / 150ul The DYNC1LI1 (25326-1-AP) by Proteintech is a Polyclonal antibody targeting DYNC1LI1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 25326-1-AP targets DYNC1LI1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: K-562 cells, HeLa cells, Jurkat cells Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: K-562 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag18191 Product name: Recombinant human DYNC1LI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 167-233 aa of BC131620 Sequence: SVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLT Predict reactive species Full Name: dynein, cytoplasmic 1, light intermediate chain 1 Calculated Molecular Weight: 523 aa, 57 kDa Observed Molecular Weight: 57-60 kDa GenBank Accession Number: BC131620 Gene Symbol: DYNC1LI1 Gene ID (NCBI): 51143 RRID: AB_2880031 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6G9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.